Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0168000_circ_g.2 |
| ID in PlantcircBase | osa_circ_010608 |
| Alias | Os12circ01113 |
| Organism | Oryza sativa |
| Position | chr12: 3434242-3435341 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os12g0168000 |
| Parent gene annotation |
5-formyltetrahydrofolate cyclo-ligase family protein. (Os12t0168 000-01);Similar to 5-formyltetrahydrofolate cyclo-ligase. (Os12t 0168000-02) |
| Parent gene strand | + |
| Alternative splicing | Os12g0168000_circ_g.1 |
| Support reads | 2/1 |
| Tissues | leaf and panicle/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0168000-02:4 Os12t0168000-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010128 |
| PMCS | 0.255375621 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3434342-3435263(-) |
| Potential amino acid sequence |
MLLEYIQWVSCEIPELRKILSLAEVAESATFYLSIITVFVFFFFAALLVVASQKGHKEV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |