Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0168000_circ_g.2 |
ID in PlantcircBase | osa_circ_010608 |
Alias | Os12circ01113 |
Organism | Oryza sativa |
Position | chr12: 3434242-3435341 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os12g0168000 |
Parent gene annotation |
5-formyltetrahydrofolate cyclo-ligase family protein. (Os12t0168 000-01);Similar to 5-formyltetrahydrofolate cyclo-ligase. (Os12t 0168000-02) |
Parent gene strand | + |
Alternative splicing | Os12g0168000_circ_g.1 |
Support reads | 2/1 |
Tissues | leaf and panicle/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0168000-02:4 Os12t0168000-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010128 |
PMCS | 0.255375621 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3434342-3435263(-) |
Potential amino acid sequence |
MLLEYIQWVSCEIPELRKILSLAEVAESATFYLSIITVFVFFFFAALLVVASQKGHKEV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |