Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0213150_circ_g.2 |
| ID in PlantcircBase | osa_circ_018499 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 5897966-5898320 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0213150 |
| Parent gene annotation |
Hypothetical protein. (Os03t0213150-00) |
| Parent gene strand | - |
| Alternative splicing | Os03g0213150_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0213100-01:1 Os03t0213100-02:1 Os03t0213100-01:1 Os03t0213100-02:1 Os03t0213150-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.745506526 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5898058-5898312(-) 5898045-5898263(-) |
| Potential amino acid sequence |
MEQCNDSPLELSTTATVDSCGAKCLPDDILTGI*(-) MTAPSNSAPRPLLIVVGLNAFQMIFSLGYEIEVGNQCRMQNDGHV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |