Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0213150_circ_g.2 |
ID in PlantcircBase | osa_circ_018499 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 5897966-5898320 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0213150 |
Parent gene annotation |
Hypothetical protein. (Os03t0213150-00) |
Parent gene strand | - |
Alternative splicing | Os03g0213150_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0213100-01:1 Os03t0213100-02:1 Os03t0213100-01:1 Os03t0213100-02:1 Os03t0213150-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.745506526 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5898058-5898312(-) 5898045-5898263(-) |
Potential amino acid sequence |
MEQCNDSPLELSTTATVDSCGAKCLPDDILTGI*(-) MTAPSNSAPRPLLIVVGLNAFQMIFSLGYEIEVGNQCRMQNDGHV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |