Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc03g025810.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000932 |
| Alias | 3:7590010|7590228 |
| Organism | Solanum lycopersicum |
| Position | chr3: 3209876-3210094 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc03g025810.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc03g025810.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.613422004 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3209998-3209933(+) 3209991-3210037(-) |
| Potential amino acid sequence |
MILDLFRLCLNFLQHRLLMMMITFIMNLTMSFSWSTMNFCTFLHFFFISFFL*(+) MVLDTSMAMNMNMNTSSIHKKKLMKKKWRKVQKFMVDHEKDMVKFMMKVIIIISNRC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |