Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0410100_circ_g.3 |
| ID in PlantcircBase | osa_circ_033491 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 12817486-12818724 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0410100 |
| Parent gene annotation |
Similar to Dihydrolipoamide S-acetyltransferase (EC 2.3.1.12). ( Os07t0410100-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0410100_circ_g.4 Os07g0410100_circ_g.5 Os07g0410100_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0410100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111814736 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12817566-12818695(-) 12817490-12818702(-) |
| Potential amino acid sequence |
MEATLAGDHLTTLSQILLLVSMVHCHVAEFTQCSRL*(-) MLRSLHNALDCERSGLVRYFSTASGSFPTKGNGAEKRIGGARFPQRKQPGKELETSKLSLGLNG SYTCRRSPNNFIPNTITGLNGSLSCCGVYTML*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |