Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d029626_circ_g.3 |
| ID in PlantcircBase | zma_circ_006570 |
| Alias | Zm01circ00081, ZmciR92 |
| Organism | Zea mays |
| Position | chr1: 80249730-80250615 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d029626 |
| Parent gene annotation |
Xanthine dehydrogenase 1 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d029626_T009:2 Zm00001d029626_T012:2 Zm00001d029626_T001:2 Zm00001d029626_T006:2 Zm00001d029626_T004:2 Zm00001d029626_T008:2 Zm00001d029626_T007:2 Zm00001d029626_T005:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.090300661 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
80250553-80249776(+) 80250555-80249782(-) |
| Potential amino acid sequence |
MTVQAPQPPSPHPSFVPRRPISELGANLADDLQFPQL*(+) MVSCYDRITKKSLHFAINACLAPLYSVEGMHIITVEGIGDRQRGLHPVQILAFEGQSLDVVKVV VELALSWSLAMTELQRNHCILQSMHAWLHFIPWKECI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |