Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0243800_circ_g.3 |
| ID in PlantcircBase | osa_circ_018824 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 7604190-7605497 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | Os03g0243800 |
| Parent gene annotation |
Nicotinamide N-methyltransferase, putative domain containing pro tein. (Os03t0243800-00) |
| Parent gene strand | + |
| Alternative splicing | Os03g0243800_circ_g.1 Os03g0243800_circ_g.2 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0243800-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116219317 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7604280-7604199(+) 7604280-7605496(-) |
| Potential amino acid sequence |
MLPISQSTKSHGDSSSRNENIVECHNDVRVCYKLPCEGSPKLNLVYRREDSLELNDIVASNRYN IDTTGLVCCWPSEEVLAYYCINHSDMFRGNF*(+) MTLNQVKATRCLSGNFVSIIFILLIVRSFL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |