Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0497500_circ_g.2 |
| ID in PlantcircBase | osa_circ_014710 |
| Alias | Os_ciR7739 |
| Organism | Oryza sativa |
| Position | chr2: 17497269-17497908 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0497500 |
| Parent gene annotation |
Similar to DNA repair protein Rad50. (Os02t0497500-01);Similar t o DNA repair protein Rad50. (Os02t0497500-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0497500_circ_g.1 Os02g0497500_circ_igg.1 Os02g0497600_circ_g.1 Os02g0497500_circ_igg.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0497500-02:3 Os02t0497500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011761 |
| PMCS | 0.344550547 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17497302-17497856(-) 17497866-17497830(-) |
| Potential amino acid sequence |
MKVRRHKHLMIKEKLCGVQTSIHYEDVC*(-) MSADINMFPKHLKDAMDEREKQKNNLSYAKGMRQMYEPFENLARELHMCPCCQRAFTPDEEDEF VKKQRTTCESTADRMNKISLECSNAEDFFQQLNKLNATYEEFVKLGKEAIPLAEKNLKQLLADE SEKAQTFDDQREAMWSPNFNPLRRCLLTLTCFPNI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |