Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0497500_circ_g.2 |
ID in PlantcircBase | osa_circ_014710 |
Alias | Os_ciR7739 |
Organism | Oryza sativa |
Position | chr2: 17497269-17497908 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os02g0497500 |
Parent gene annotation |
Similar to DNA repair protein Rad50. (Os02t0497500-01);Similar t o DNA repair protein Rad50. (Os02t0497500-02) |
Parent gene strand | - |
Alternative splicing | Os02g0497500_circ_g.1 Os02g0497500_circ_igg.1 Os02g0497600_circ_g.1 Os02g0497500_circ_igg.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0497500-02:3 Os02t0497500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011761 |
PMCS | 0.344550547 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17497302-17497856(-) 17497866-17497830(-) |
Potential amino acid sequence |
MKVRRHKHLMIKEKLCGVQTSIHYEDVC*(-) MSADINMFPKHLKDAMDEREKQKNNLSYAKGMRQMYEPFENLARELHMCPCCQRAFTPDEEDEF VKKQRTTCESTADRMNKISLECSNAEDFFQQLNKLNATYEEFVKLGKEAIPLAEKNLKQLLADE SEKAQTFDDQREAMWSPNFNPLRRCLLTLTCFPNI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |