Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_07G007000_circ_g.1 |
| ID in PlantcircBase | gma_circ_001597 |
| Alias | Gm07circRNA519, gma-circRNA0997, circRNA753 |
| Organism | Glycine max |
| Position | chr7: 511341-511575 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI, find_circ, CIRI, CIRCexplorer |
| Parent gene | GLYMA_07G007000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_07G007000_circ_igg.1 GLYMA_07G006900_circ_igg.1 GLYMA_07G007000_circ_igg.2 GLYMA_07G006900_circ_ag.1 GLYMA_07G006900_circ_ag.2 GLYMA_07G006900_circ_g.1 GLYMA_07G006900_circ_g.2 GLYMA_07G006900_circ_g.3 GLYMA_07G006900_circ_g.4 GLYMA_07G006900_circ_ag.5 GLYMA_07G006900_circ_ag.6 GLYMA_07G006900_circ_g.7 GLYMA_07G007000_circ_g.2 |
| Support reads | NA |
| Tissues | root, flower bud, pod |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH47067:1 KRH47068:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.427039007 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
511415-511375(+) |
| Potential amino acid sequence |
MEQGRERTLTESMIMMSIMIWAIQMVVILAQSLVGLASIPTLAGLEQEEKGPGQTYLPSATPAP LLKYRKEELEVLRGDGTGKRKDFDRIYDYDVYNDLGNPDGGDPRPILGGSSIYPYPRRVRTGRE RTRTDISSKCHTSSTT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Chen et al., 2018; Ma et al., 2021a |