Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G35840_circ_g.2 |
| ID in PlantcircBase | ath_circ_016706 |
| Alias | AT2G35840_C2 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 15054084-15054383 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT2G35840 |
| Parent gene annotation |
Probable sucrose-phosphatase 2 |
| Parent gene strand | + |
| Alternative splicing | AT2G35840_circ_g.1 AT2G35840_circ_g.3 AT2G35840_circ_g.4 AT2G35840_circ_g.5 |
| Support reads | 21 |
| Tissues | whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G35840.1:1 AT2G35840.2:1 AT2G35840.4:1 AT2G35840.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.631708466 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15054249-15054380(+) |
| Potential amino acid sequence |
MSVGTEITYGNSMVPDHGWVEALNNKWDLGIVKQEASNFPELKLQVDHHDPENLSLLRFNSLWE HAYRHDSLLVFSTGRSPTLYKELRKEKPLLTPDITIMSVGTEITYGNSMVPDHGWVEALNNKWD LGIVKQEASNFPELKLQVDHHDPENLSLLRFNSLWEHAYRHDSLLVFSTGRSPTLYKELRKEKP LLTPDITIMSVGTEITYGNSMVPDHGWVEALNNKWDLGIVKQEASNFPELKLQVDHHDPENLSL LRFNSLWEHAYRHDSLLVFSTGRSPTLYKELRKEKPLLTPDITIMSVGTEITYGNSMVPDHGWV EALNNKWDLGIVKQEASNFPELKLQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |