Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G35840_circ_g.2 |
ID in PlantcircBase | ath_circ_016706 |
Alias | AT2G35840_C2 |
Organism | Arabidpsis thaliana |
Position | chr2: 15054084-15054383 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
Parent gene | AT2G35840 |
Parent gene annotation |
Probable sucrose-phosphatase 2 |
Parent gene strand | + |
Alternative splicing | AT2G35840_circ_g.1 AT2G35840_circ_g.3 AT2G35840_circ_g.4 AT2G35840_circ_g.5 |
Support reads | 21 |
Tissues | whole_plant, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G35840.1:1 AT2G35840.2:1 AT2G35840.4:1 AT2G35840.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.631708466 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15054249-15054380(+) |
Potential amino acid sequence |
MSVGTEITYGNSMVPDHGWVEALNNKWDLGIVKQEASNFPELKLQVDHHDPENLSLLRFNSLWE HAYRHDSLLVFSTGRSPTLYKELRKEKPLLTPDITIMSVGTEITYGNSMVPDHGWVEALNNKWD LGIVKQEASNFPELKLQVDHHDPENLSLLRFNSLWEHAYRHDSLLVFSTGRSPTLYKELRKEKP LLTPDITIMSVGTEITYGNSMVPDHGWVEALNNKWDLGIVKQEASNFPELKLQVDHHDPENLSL LRFNSLWEHAYRHDSLLVFSTGRSPTLYKELRKEKPLLTPDITIMSVGTEITYGNSMVPDHGWV EALNNKWDLGIVKQEASNFPELKLQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |