Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G110020_circ_g.1 |
| ID in PlantcircBase | csa_circ_001420 |
| Alias | Chr3:5393611_5396118 |
| Organism | Cucumis sativus |
| Position | chrChr3: 5393611-5396118 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa3G110020 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | Chr3_circ_ig.10 Csa3G110020_circ_g.2 Csa3G110020_circ_g.3 Csa3G110020_circ_g.4 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa3G110020.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.11791359 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5396077-5396112(-) |
| Potential amino acid sequence |
MGGKDVIYMKQQHSSTLQPSEPSEVQKSLKEMADKRFSETIAQYGMGSERLYNNDKDIVPICKR RGGSDRISLPHHEWLQTVQLEPDVISMSFIPITSLLNGVPGSGFLSHAINLYLRYKPPIEELHQ FLEFQLPRQWAPIFSELPLGPQRKQHNLASLQFSLMGSKLYVNTTPVY* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |