Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G31440_circ_g.1 |
ID in PlantcircBase | ath_circ_015890 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 13399819-13399944 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G31440 |
Parent gene annotation |
Gamma-secretase subunit APH1-like |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 5 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G31440.1:1 AT2G31440.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.236887037 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13399851-13399821(-) |
Potential amino acid sequence |
MFEGAIFSHLCWWFRSWCGACCILLFEPLNSSVWSSHILCRKMFEGAIFSHLCWWFRSWCGACC ILLFEPLNSSVWSSHILCRKMFEGAIFSHLCWWFRSWCGACCILLFEPLNSSVWSSHILCRKMF EGAIFSHL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |