Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0127500_circ_g.1 |
| ID in PlantcircBase | osa_circ_026414 |
| Alias | Os_ciR5460 |
| Organism | Oryza sativa |
| Position | chr5: 1566447-1566780 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0127500 |
| Parent gene annotation |
Similar to Leucoanthocyanidin dioxygenase-like protein. (Os05t01 27500-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0127500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.25269763 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1566730-1566666(-) |
| Potential amino acid sequence |
MAVMAVGLGVEEGRLQEAFGGREGAGVCVRVNYYPRCPQPDLTLGLSSHSDPGGMTVLLVDDRV KGLQVRHAGAWVTVDPVPDAFIINVGDQIQGDDDRVQRGGEEVMREVDGGDGGGARGRRREATG GVWW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |