Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0274100_circ_g.4 |
| ID in PlantcircBase | osa_circ_014234 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 10006073-10007357 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0274100 |
| Parent gene annotation |
3-hydroxyacyl-CoA dehydrogenase, Multifunctional protein, RNA- and microtubule-binding protein, Salicylic acid (SA) biosynthesi s, Maintenance of root meristem activity, Beta -oxidation of fat ty acids (Os02t0274100-01);Similar to Peroxisomal fatty acid bet a-oxidation multifunctional protein. (Os02t0274100-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0274100_circ_g.5 Os02g0274100_circ_g.6 Os02g0274100_circ_g.7 Os02g0274100_circ_g.8 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0274100-01:2 Os02t0274100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.145222536 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10007117-10006079(+) 10006172-10007308(-) |
| Potential amino acid sequence |
MPLLEIVRTEKTSPQAILDLITVGKMIKKVPVVVGNCTGFAVNRTFFPYTQGSHLLVSIGIDVF RIDRVISSFGMPMGPFQLS*(+) MVDVFVASMQWGGHTFSRSENIDCFKGIFSMTAEKVPLACQSCLLLDQF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |