Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G055400_circ_g.1 |
| ID in PlantcircBase | gra_circ_000334 |
| Alias | Chr04:5302827|5303836 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 5302827-5303836 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G055400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G055400.1:5 Gorai.004G055400.2:5 Gorai.004G055400.3:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000111* |
| PMCS | 0.142620198 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5302912-5303400(-) 5303583-5303803(-) |
| Potential amino acid sequence |
MRRCCCCCCCFICCTGSIRSKIDRPKAYRKQLEKFLHMVIVVSPFMLGIRKISLGYYWLKVFSL YELRWRLRSVLFQSGGFLGFQHRCLCMISSMNFKREAVIWQL*(-) METPVSSVSIRRILRVPAQMPLYDILNEFQKGSSHMAAVVKVKGKTKDLQFVDDGERFDNHKVT NRNSQLTDPLLTKQDSVLVNVEKSSAVKETMNTLQCFSEDTEDGEVIGIITLEDVFEELLQEEI VDETDVYVDVHKRICVAAAAAAVASSVARAPSDRRLIGQKPTGSNWKNSCTWS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |