Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0557900_circ_g.3 |
| ID in PlantcircBase | osa_circ_038043 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 27925006-27925266 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0557900 |
| Parent gene annotation |
Inosine/uridine-preferring nucleoside hydrolase domain containin g protein. (Os08t0557900-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0557900_circ_g.1 Os08g0557900_circ_g.2 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0557900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.33833145 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27925049-27925166(+) 27925201-27925007(+) 27925260-27925257(-) |
| Potential amino acid sequence |
MSCSLTQQERILSRILCGGVAKYGCEPYDLHSWSSERHKDCHAIILRGSALPSATGTSGCPALS HSKSAF*(+) MVVSPMISTVGALNAIRIVMLSS*(+) MTILMAFRAPTVEIIGLTTIFGNTTTKNATQNALLLCERAGHPEVPVAEGSAEPLKMIA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |