Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0557900_circ_g.3 |
ID in PlantcircBase | osa_circ_038043 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 27925006-27925266 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0557900 |
Parent gene annotation |
Inosine/uridine-preferring nucleoside hydrolase domain containin g protein. (Os08t0557900-01) |
Parent gene strand | - |
Alternative splicing | Os08g0557900_circ_g.1 Os08g0557900_circ_g.2 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0557900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.33833145 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27925049-27925166(+) 27925201-27925007(+) 27925260-27925257(-) |
Potential amino acid sequence |
MSCSLTQQERILSRILCGGVAKYGCEPYDLHSWSSERHKDCHAIILRGSALPSATGTSGCPALS HSKSAF*(+) MVVSPMISTVGALNAIRIVMLSS*(+) MTILMAFRAPTVEIIGLTTIFGNTTTKNATQNALLLCERAGHPEVPVAEGSAEPLKMIA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |