Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G195400_circ_g.3 |
| ID in PlantcircBase | gra_circ_001440 |
| Alias | Chr13:49835688|49837241 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 49835688-49837241 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G195400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.013G195400_circ_g.1 orai.013G195400_circ_g.2 |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.013G195400.2:5 Gorai.013G195400.1:6 Gorai.013G195400.3:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.107159465 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
49837147-49835748(+) |
| Potential amino acid sequence |
MHLMTSVCVNSAGDFSSSFLLLRTELIPSINPFKLAPSRLAPSKLASVRSAL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |