Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G26990_circ_g.1 |
ID in PlantcircBase | ath_circ_015102 |
Alias | Ath_circ_FC1355 |
Organism | Arabidpsis thaliana |
Position | chr2: 11521132-11521206 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G26990 |
Parent gene annotation |
COP9 signalosome complex subunit 2 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G26990.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.280005556 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11521141-11521134(-) 11521157-11521203(+) |
Potential amino acid sequence |
MTKRLWFKTNLKLCNIWFDIGEYRRMTKRLWFKTNLKLCNIWFDIGEYRRMTKRLWFKTNLKLC NIWFDIGEYRRMTK(-) MSNQMLQSLRFVLNQSLLVIRLYSPMSNQMLQSLRFVLNQSLLVIRLYSPMSNQMLQSLRFVLN QSLLVIRLYSPMSNQMLQSLRFVLNQS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |