Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G38510_circ_g.12 |
ID in PlantcircBase | ath_circ_035415 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 18014381-18014479 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT4G38510 |
Parent gene annotation |
ATPase, V1 complex, subunit B protein |
Parent gene strand | - |
Alternative splicing | AT4G38510_circ_g.3 AT4G38510_circ_g.4 AT4G38510_circ_g.5 AT4G38510_circ_g.6 AT4G38510_circ_g.7 AT4G38510_circ_g.8 AT4G38510_circ_g.9 AT4G38510_circ_g.10 AT4G38510_circ_g.11 AT4G38510_circ_g.13 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G38510.3:1 AT4G38510.1:1 AT4G38510.2:1 AT4G38510.5:1 AT4G38510.4:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.299066582 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18014440-18014383(-) |
Potential amino acid sequence |
MELPDVVKFSKLMERKLLFRGLNTKKLSISVLGMELPDVVKFSKLMERKLLFRGLNTKKLSISV LGMELPDVVKFSKLMERKLLFRGLNTKKLSISVLGMELPDVVKFSKLMERKLLF(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |