Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0707600_circ_g.1 |
ID in PlantcircBase | osa_circ_010240 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 28954425-28954804 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0707600 |
Parent gene annotation |
Similar to Sterol 4-alpha-methyl-oxidase (Fragment). (Os11t07076 00-01);Similar to Sterol 4-alpha-methyl-oxidase (Fragment). (Os1 1t0707600-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0707600-01:2 Os11t0707600-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.406362817 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28954600-28954784(-) |
Potential amino acid sequence |
MEAPTFMTIITVCSTPNQETTPLLLFTWTDMLHPLA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |