Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G086300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000051 |
| Alias | Chr01:9206096|9206310 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 9206096-9206310 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G086300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.001G086200_circ_ag.1 |
| Support reads | 6 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.001G086300.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000053 |
| PMCS | 0.844959264 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9206271-9206260(-) 9206138-9206232(-) |
| Potential amino acid sequence |
MQEIVGKRLPKFTEEEVKMVNGSFDYVGINQYTTSYISNPTTPSNVTSYQSDWNAAFASFYIPF GMASIPEQCKK*(-) MLQATNQIGMQPLPVSTSHSVWRVSQNNARNSRQKAAEVY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |