Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d006496_circ_g.2 |
ID in PlantcircBase | zma_circ_007370 |
Alias | Zm02circ00103, GRMZM2G169615_C1 |
Organism | Zea mays |
Position | chr2: 209841387-209841711 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d006496 |
Parent gene annotation |
Polyadenylate-binding protein RBP45C |
Parent gene strand | + |
Alternative splicing | Zm00001d006496_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d006496_T004:2 Zm00001d006496_T003:2 Zm00001d006496_T002:1 Zm00001d006496_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.220199868 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
209841641-209841708(+) 209841648-209841402(+) |
Potential amino acid sequence |
MLNGSQIGGQKARLSWGRSTQNRQVFVGGLDSNVDEEYLRQIFTPYGEISYVKIPVGKHCGFVQ FTSRSCAEEAIQMLNGSQIGGQKARLSWGRSTQNRQVFVGGLDSNVDEEYLRQIFTPYGEISYV KIPVGKHCGFVQFTSRSCAEEAIQMLNGSQIGGQKARLSWGRSTQNRQVFVGGLDSNVDEEYLR QIFTPYGEISYVKIPVGKHCGFVQFTSRSCAEEAIQMLNGSQIGGQKARLSWGRSTQNRQ(+) MGVRLVDRKLGFHGAVVLKTDRSLWVG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |