Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc10g083960.1_circ_g.2 |
| ID in PlantcircBase | sly_circ_003208 |
| Alias | 10:62980479|62981074, Slcirc157 |
| Organism | Solanum lycopersicum |
| Position | chr10: 63655947-63656542 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc10g083960.1 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | Solyc10g083960.1_circ_g.1 |
| Support reads | 9/19 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc10g083960.1.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.851922359 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
63656246-63655962(+) 63656036-63656537(-) |
| Potential amino acid sequence |
MDILRLDFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRF CFTY*(+) MSFHHQQHLVNYFLPLYAEHSLLSVGEAKPV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018; Wang et al., 2018b |