Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc10g083960.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003208 |
Alias | 10:62980479|62981074, Slcirc157 |
Organism | Solanum lycopersicum |
Position | chr10: 63655947-63656542 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc10g083960.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | Solyc10g083960.1_circ_g.1 |
Support reads | 9/19 |
Tissues | fruit/leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc10g083960.1.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.851922359 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
63656246-63655962(+) 63656036-63656537(-) |
Potential amino acid sequence |
MDILRLDFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPILDWSYRF CFTY*(+) MSFHHQQHLVNYFLPLYAEHSLLSVGEAKPV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Yin et al., 2018; Wang et al., 2018b |