Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0787800_circ_g.1 |
| ID in PlantcircBase | osa_circ_016853 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 33476810-33477787 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0787966 |
| Parent gene annotation |
Hypothetical protein. (Os02t0787966-00) |
| Parent gene strand | + |
| Alternative splicing | Os02g0787800_circ_g.2 Os02g0787800_circ_g.3 Os02g0787800_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0787800-01:3 Os02t0787800-01:3 Os02t0787966-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.233822163 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33476960-33476834(-) |
| Potential amino acid sequence |
MESCVCSDGWRAMETTTPTGAVNHYRDKQSSLPFSDDKWGAMRSSPISISVRSLVVLNLYNYGS GRHPWGDLKPDYLEKKGFVEAHSDDGLLEIFGLKEGWHASFVMAELIKAKHIAQAAAIKFEMRG GQWNRAYVQMDGEPWKQPLLQEQSTIIEINKVPYPSLMINGEQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |