Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d019664_circ_g.2 |
ID in PlantcircBase | zma_circ_009271 |
Alias | zma_circ_0002724 |
Organism | Zea mays |
Position | chr7: 48970751-48977034 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d019664 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d019664_T010:5 Zm00001d019664_T013:5 Zm00001d019664_T001:5 Zm00001d019664_T015:5 Zm00001d019664_T021:5 Zm00001d019664_T002:5 Zm00001d019664_T012:5 Zm00001d019664_T004:5 Zm00001d019664_T006:5 Zm00001d019664_T011:5 Zm00001d019664_T007:5 Zm00001d019664_T017:5 Zm00001d019664_T008:5 Zm00001d019664_T020:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.091980822 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
48976925-48977016(-) 48970781-48976982(-) |
Potential amino acid sequence |
MTCRMTASKQNKRQTNCTNSEQCRPGKKAKFDTSHCLVSLKPHISLKWDQYLRKVVPEKEQVGI LWSDLAPFMESQKHCSGLADVMYVPPEIFSLKSLKGVLSYEAWSTSLTEAERKFLIQFLPSETD AEENVKLLLTGQNHHFGNPFLSWSSSLCYGDIHPDALLNKEKHIKKDEKAYHVNLLNYHSNMVE TLKSWRKRWLSCGDTENLFRDNPSNQMQGVMQLKATNSGMPMKVAQRIDVSKFMSYIKVLHDSL *(-) MFQSLCHTSKCSMILYNIRNKLGLKQE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |