Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G19170_circ_g.8 |
| ID in PlantcircBase | ath_circ_022665 |
| Alias | At_ciR2857, Ath_circ_FC2069 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 6628481-6628699 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, CIRI-full |
| Parent gene | AT3G19170 |
| Parent gene annotation |
Presequence protease 1, chloroplastic/mitochondrial |
| Parent gene strand | - |
| Alternative splicing | AT3G19170_circ_g.6 AT3G19170_circ_g.7 |
| Support reads | 3/1 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G19170.1:1 AT3G19170.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.541594049 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6628631-6628483(-) |
| Potential amino acid sequence |
MTEEDLAELARATEELKLKQETPDPPEALRCVPSLNLGDIPKEPTYVPTEPDPEKATQEEVEEK NILEKVKAAMTEEDLAELARATEELKLKQETPDPPEALRCVPSLNLGDIPKEPTYVPTEPDPEK ATQEEVEEKNILEKVKAAMTEEDLAELARATEELKLKQETPDPPEALRCVPSLNLGDIPKEPTY VPTEPDPEKATQEEVEEKNILEKVKAAMTEEDLAELARATEELKLKQETPDPPEALRCVPSLNL GDIPKEPTYVPTE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a |