Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0301500_circ_g.2 |
| ID in PlantcircBase | osa_circ_036638 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 12412486-12414374 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0301500 |
| Parent gene annotation |
Similar to Sucrose-phosphate synthase 2 (EC 2.4.1.14) (Fragment) . (Os08t0301500-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0301500_circ_g.3 Os08g0301500_circ_g.4 Os08g0301500_circ_g.5 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0301500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.115941967 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12412496-12412495(+) 12414250-12414319(-) |
| Potential amino acid sequence |
MRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRLAKQRLEREKARRYAAADMSEDLSEGEKG ENINESSSTHDESTRGRMPRIGSTDAIEAWASQHKDKKLYIVLIRRRR*(+) MFSPFSPSDRSSDISAAAYLRAFSRSRRCLAKREASSPSICFFFLARFQILHDMFSSRVFLSCG LLIAAVLSEQCIAFYPCADLPMPQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |