Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0217500_circ_g.2 |
ID in PlantcircBase | osa_circ_008869 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 6115711-6123987 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0217500 |
Parent gene annotation |
Similar to mRNA capping enzyme, C-terminal domain containing pro tein, expressed. (Os11t0217500-01) |
Parent gene strand | - |
Alternative splicing | Os11g0217500_circ_g.1 Os11g0217500_circ_g.3 Os11g0217500_circ_g.4 Os11g0217500_circ_g.5 Os11g0217500_circ_g.6 Os11g0217500_circ_g.7 Os11g0217500_circ_g.8 Os11g0217500_circ_g.9 Os11g0217500_circ_g.10 Os11g0217500_circ_g.11 Os11g0217500_circ_g.12 Os11g0217500_circ_g.13 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0217500-01:14 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.100941945 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6119465-6123966(-) |
Potential amino acid sequence |
MMLIMRDGCFLIDRNFCFRRVQMRFPHRNLNEGLHEMTLIDGEMIIDTVPDSGLKRRYLAYDLM ALDAVSKTKLPFSERWRLLEDEIIRPRYYEKKQFESGVKSNPMYKYDMELFSVRRKDFWLLSTV TKLLKEFIPSLSHDADGLIFQGWDDPYVTRTHEGLLKWKYPSMNSVDFLFEVGGDNRQLVFLYE RGKKKLMDGSRIAFPNEDPSSISGRIVECSWNKEEGCWVCMRIRSDKSTPNDINTYRKVQISKR Y*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |