Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0217500_circ_g.2 |
| ID in PlantcircBase | osa_circ_008869 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 6115711-6123987 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0217500 |
| Parent gene annotation |
Similar to mRNA capping enzyme, C-terminal domain containing pro tein, expressed. (Os11t0217500-01) |
| Parent gene strand | - |
| Alternative splicing | Os11g0217500_circ_g.1 Os11g0217500_circ_g.3 Os11g0217500_circ_g.4 Os11g0217500_circ_g.5 Os11g0217500_circ_g.6 Os11g0217500_circ_g.7 Os11g0217500_circ_g.8 Os11g0217500_circ_g.9 Os11g0217500_circ_g.10 Os11g0217500_circ_g.11 Os11g0217500_circ_g.12 Os11g0217500_circ_g.13 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0217500-01:14 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.100941945 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6119465-6123966(-) |
| Potential amino acid sequence |
MMLIMRDGCFLIDRNFCFRRVQMRFPHRNLNEGLHEMTLIDGEMIIDTVPDSGLKRRYLAYDLM ALDAVSKTKLPFSERWRLLEDEIIRPRYYEKKQFESGVKSNPMYKYDMELFSVRRKDFWLLSTV TKLLKEFIPSLSHDADGLIFQGWDDPYVTRTHEGLLKWKYPSMNSVDFLFEVGGDNRQLVFLYE RGKKKLMDGSRIAFPNEDPSSISGRIVECSWNKEEGCWVCMRIRSDKSTPNDINTYRKVQISKR Y*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |