Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d019573_circ_g.1 |
ID in PlantcircBase | zma_circ_009263 |
Alias | Zm07circ00032, zma_circ_0002358, GRMZM2G173923_C1 |
Organism | Zea mays |
Position | chr7: 43798587-43798812 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d019573 |
Parent gene annotation |
crs2 associated factor1 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d019573_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.383286132 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
43798687-43798645(+) 43798757-43798645(+) 43798632-43798793(-) |
Potential amino acid sequence |
MLWKPVAPVYPRLVTKVPGGLTPDEATEMRTRGHQLPPICKLGKSWRKSNTPPRGCHISFSW*( +) MRPQKCAREDISYHQFVNLEKVGGKVIHRQGGVIFLFRGRNYNYRTRPCFPLMLWKPVAPVYPR LVTKVPGGLTPDEATEMRTRGHQLPPICKLGKSWRKSNTPPRGCHISFSW*(+) MTPPWRCITFPPTFSKFTNWW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |