Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G292300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000992 |
| Alias | Chr09:25265833|25266557 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 25265833-25266557 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G292300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.009G292300.2:1 Gorai.009G292300.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.286799092 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25266534-25265934(+) 25265976-25266505(-) |
| Potential amino acid sequence |
MPDGVNAKDLQGVIAKSRISHTPNLDTAVVSQILRSEFMMLG*(+) MDTERKLINTFFLHPNIINSDLRIWDTTAVSRFGVWLILDLAITPCRSFALTPSGMILFSDFHF R*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |