Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0556600_circ_g.1 |
| ID in PlantcircBase | osa_circ_015024 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 21044658-21047859 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os02g0556600 |
| Parent gene annotation |
Similar to Pherophorin-dz1 protein precursor. (Os02t0556600-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0556600_circ_g.2 Os02g0556600_circ_g.3 Os02g0556600_circ_g.4 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0556600-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.101954823 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21046790-21047820(-) |
| Potential amino acid sequence |
MKQQSVSDKLDLQPDISHWIVRSYLLHYGYQDTLNSFDMASETDPPSNHQNGYGEPPEMYGLSH RKLLRQLIMSGDIDSAFKKLGEWYPQVIKDETSIICFLLHSQRFIEFIGAGQLEDAVKYARSNL ANFLTHKAFDGLLKEKWISSWILSKRN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |