Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0556600_circ_g.1 |
ID in PlantcircBase | osa_circ_015024 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 21044658-21047859 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os02g0556600 |
Parent gene annotation |
Similar to Pherophorin-dz1 protein precursor. (Os02t0556600-01) |
Parent gene strand | - |
Alternative splicing | Os02g0556600_circ_g.2 Os02g0556600_circ_g.3 Os02g0556600_circ_g.4 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0556600-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.101954823 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21046790-21047820(-) |
Potential amino acid sequence |
MKQQSVSDKLDLQPDISHWIVRSYLLHYGYQDTLNSFDMASETDPPSNHQNGYGEPPEMYGLSH RKLLRQLIMSGDIDSAFKKLGEWYPQVIKDETSIICFLLHSQRFIEFIGAGQLEDAVKYARSNL ANFLTHKAFDGLLKEKWISSWILSKRN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |