Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0843500_circ_g.2 |
| ID in PlantcircBase | osa_circ_022668 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 35449451-35450466 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0843500 |
| Parent gene annotation |
Similar to Sarcoplasmic reticulum protein (With alternative spli cing). (Os03t0843500-01);Similar to Sarcoplasmic reticulum prote in (With alternative splicing). (Os03t0843500-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0843500_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0843500-01:3 Os03t0843500-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.259326468 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35450392-35449476(+) 35450433-35450412(-) |
| Potential amino acid sequence |
MSALLDLNSSTTSMVLILSSVFPSKSFSKPLLLP*(+) MEVVEELRSKRADMQATLLLDAFNKDRASLPQPTPTPQMASVPAPAPPDARTQEMINEKIKKAE ELGEQGMVDEAQKVMEEAEALKKILKGKLMIKSRPWKWWKN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |