Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G002000_circ_g.2 |
| ID in PlantcircBase | gra_circ_001180 |
| Alias | Chr11:182944|187991 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 182944-187991 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G002000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.011G002000_circ_g.1 |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G002000.3:9 Gorai.011G002000.4:9 Gorai.011G002000.5:9 Gorai.011G002000.2:9 Gorai.011G002000.7:4 Gorai.011G002000.6:7 Gorai.011G002000.1:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.484712657 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
187983-183060(+) 182983-187928(-) |
| Potential amino acid sequence |
MKRCLSFLWDMVLELHLLPCLLSWVVGYIQKQLMLGQILLEK*(+) MKLQNHIPQEGEAPFHRNTGAITSVIVASILIST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |