Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G26070_circ_g.1 |
| ID in PlantcircBase | ath_circ_023865 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 9527324-9527623 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G26070 |
| Parent gene annotation |
Probable plastid-lipid-associated protein 4, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | 3_circ_ag.2 AT3G26070_circ_g.3 3_circ_ag.4 3_circ_ag.5 |
| Support reads | 4 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G26070.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.20717325 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9527597-9527620(+) |
| Potential amino acid sequence |
METWPFYNSLARKVEAVNPTKEPLKSDLVNGKWELIYTTSASILQAKKPRFLRSITNYQSINVD TLKVQNMETWPFYNSLARKVEAVNPTKEPLKSDLVNGKWELIYTTSASILQAKKPRFLRSITNY QSINVDTLKVQNMETWPFYNSLARKVEAVNPTKEPLKSDLVNGKWELIYTTSASILQAKKPRFL RSITNYQSINVDTLKVQNMETWPFYNS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |