Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_07G133500_circ_g.1 |
| ID in PlantcircBase | gma_circ_008447 |
| Alias | circRNA3532 |
| Organism | Glycine max |
| Position | chr7: 15810670-15811008 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | CIRI, CIRCexplorer |
| Parent gene | GLYMA_07G133500 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | pod |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH49120:1 KRH49121:1 KRH49119:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.483025639 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15810870-15810775(+) |
| Potential amino acid sequence |
MSSSSSETVLLWMGLRVSKHMIPSKQSSNPSLLSALTAWTLSEFVKIVLCGLRLAILRANSMAF SDGLQIIGVFGKTVWGLG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021a |