Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0194800_circ_g.1 |
ID in PlantcircBase | osa_circ_043561 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 4870086-4871214 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os12g0194800 |
Parent gene annotation |
tRNA pseudouridine synthase family protein. (Os12t0194800-01);Si milar to Pseudouridylate synthase. (Os12t0194800-02) |
Parent gene strand | + |
Alternative splicing | Os12g0194800_circ_g.2 Os12g0194800_circ_g.3 Os12g0194800_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CA-AG |
Number of exons covered | Os12t0194800-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.131391216 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4870691-4871211(+) 4870094-4870134(-) |
Potential amino acid sequence |
MLPPHEPGVVKRAVNHFLEAFHKFIGQPVSIFCSSRTDTGVHALSNVCHVDVERISKRKPGEML PPHEPGVVKRAVNHFLEAFHKFIGQPVSIFCSSRTDTGVHALSNVCHVDVERISKRKPGEMLPP HEPGVVKRAVNHFLEAFHKFIGQPVSIFCSSRTDTGVHALSNVCHVDVERISKRKPGEMLPPHE PGVVKRAVNHFL(+) MPLENGSLHVLQLQAHEVATFHQAFFYLSAPRQHDKHLIKHEHLCPFD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |