Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d027768_circ_g.1 |
ID in PlantcircBase | zma_circ_006415 |
Alias | zma_circ_0000265 |
Organism | Zea mays |
Position | chr1: 13171575-13173080 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d027768 |
Parent gene annotation |
Putative ion channel POLLUX-like 2 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d027768_T018:2 Zm00001d027768_T007:4 Zm00001d027768_T002:4 Zm00001d027768_T010:3 Zm00001d027768_T024:4 Zm00001d027768_T016:2 Zm00001d027768_T011:1 Zm00001d027768_T003:4 Zm00001d027768_T023:4 Zm00001d027768_T001:1 Zm00001d027768_T022:2 Zm00001d027768_T014:3 Zm00001d027768_T020:4 Zm00001d027768_T021:2 Zm00001d027768_T008:2 Zm00001d027768_T004:3 Zm00001d027768_T012:3 Zm00001d027768_T005:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.067016174 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13172908-13171764(+) 13171599-13173043(-) 13171654-13173062(-) |
Potential amino acid sequence |
MIRLWYLPVWKNSFSPKRGRTTERNRQNMKWIQMHLSLYWLYNPVNKLHLFLSLSRLPMQPLVN F*(+) MHLYPLHILSVSFSSSSSLG*(-) MIGTGAICLQGCRANRETNASVSTSYFVCFFQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |