Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0837300_circ_g.1 |
ID in PlantcircBase | osa_circ_022625 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 35191772-35194799 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0837300 |
Parent gene annotation |
Similar to Nicotinate phosphoribosyltransferase-like protein. (O s03t0837300-01);Nicotinate phosphoribosyltransferase, Leaf senes cence (Os03t0837300-02) |
Parent gene strand | + |
Alternative splicing | Os03g0837300_circ_g.2 Os03g0837300_circ_g.3 Os03g0837300_circ_g.4 Os03g0837300_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0837300-02:9 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013867 |
PMCS | 0.22559894 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35191903-35191774(+) |
Potential amino acid sequence |
MPTCEDGFFEYLSSIDCSDVEVYAIPEGSVVFPKVPLMIIEGPVAVIQLLETPFLSLVNYASLV TTNAARHRLVAGKSKNLLEFGLRRAQGPDGGISASRYCYMGGFDATSNVAAGWLFGIPIRGTHS HAFVSSFMGLDDIIDRTLASSDGSNKCEDFVSLVQNWLARIKDAGSLRGTFRETNLSELAAFTS YALAFPNSFLALVDTYDVMRSGVPNFCAVALALNDMGYKAAGIRLDSGDLAYLSVETRKFFRAI EEEFGFIGFGKMNITASNDLNEETIDALNKQL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |