Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G51310_circ_g.4 |
| ID in PlantcircBase | ath_circ_026934 |
| Alias | At_ciR5672 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 19046232-19046485 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT3G51310 |
| Parent gene annotation |
Vacuolar protein sorting-associated protein 35C |
| Parent gene strand | - |
| Alternative splicing | AT3G51310_circ_g.3 AT3G51310_circ_g.5 AT3G51310_circ_g.6 AT3G51310_circ_g.7 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G51310.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.231477394 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19046405-19046234(-) |
| Potential amino acid sequence |
MSKIIFTVRKHIVAGGPKRLPLTIPPLVFSALKIDEEDFQEEQNLVARLVNKLYIDDPEEMSKI IFTVRKHIVAGGPKRLPLTIPPLVFSALKIDEEDFQEEQNLVARLVNKLYIDDPEEMSKIIFTV RKHIVAGGPKRLPLTIPPLVFSALKIDEEDFQEEQNLVARLVNKLYIDDPEEMSKIIFTVRKHI VAGGPKRLPLTIPPLVFSALK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |