Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0540300_circ_g.3 |
ID in PlantcircBase | osa_circ_037889 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 27050093-27050265 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0540300 |
Parent gene annotation |
Zinc finger, C6HC-type domain containing protein. (Os08t0540300- 01) |
Parent gene strand | + |
Alternative splicing | Os08g0540300_circ_g.4 Os08g0540300_circ_g.5 Os08g0540300_circ_g.6 Os08g0540300_circ_g.7 Os08g0540300_circ_g.8 Os08g0540300_circ_g.9 Os08g0540300_circ_g.10 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0540300-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.32803396 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27050168-27050110(+) |
Potential amino acid sequence |
MVLQNMINKLAKDDDKVRYARFILRAYVEDSKKVILVLQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |