Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | CSA029484_g_circ1 |
| ID in PlantcircBase | csi_circ_001321 |
| Alias | Cs-circRNA2263 |
| Organism | Camellia sinensis |
| Position | chrSc0001409: 163655-164388 JBrowse» |
| Reference genome | v1 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, CIRI2 |
| Parent gene | CSA029484 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | NA-NA |
| Splicing signals | CT-AC |
| Number of exons covered | CSA029484.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_025370* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
164362-164385(-) 164343-163700(+) |
| Potential amino acid sequence |
MVATEASREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRA SWRIISSIEQKEESRGNEDHVSIIKEYRGKIEAELSKICDGILNLLESHLIPSASSAESKVFYL KMKGDYHRYLAEFKTGSERKEAAESTLLAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILN SPDRACNLAKQK*(-) MLQLPPYLLCYTNTYFCFARLQARSGELRIS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Tong et al., 2018 |