Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038085_circ_g.2 |
ID in PlantcircBase | zma_circ_009098 |
Alias | zma_circ_0002365 |
Organism | Zea mays |
Position | chr6: 147229548-147230690 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d038085 |
Parent gene annotation |
Protein RETICULATA-RELATED 4 chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d038085_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d038085_T001:4 Zm00001d038085_T002:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_027744* |
PMCS | 0.125924132 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
147229552-147229557(+) 147230658-147229642(+) 147229641-147230689(-) |
Potential amino acid sequence |
MAIVADFMLVWLPAPTVSLQPPLAMNSGAIAKFFYNCPDNAFQVALSGTSYSLLQRVGAILRNG AKLFAVGTSASLIGTGVTNALIKARQAASKDFAGEVENIPILSTSVAYGVYMAVSSNLRSWQ*( +) MVCTWQFPVTSGHGNSCRFYACMASCSNRVFTATTSDEFWSHC*(+) MAPEFIASGGCKDTVGAGSHTSIKSATIAMT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |