Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d038085_circ_g.2 |
| ID in PlantcircBase | zma_circ_009098 |
| Alias | zma_circ_0002365 |
| Organism | Zea mays |
| Position | chr6: 147229548-147230690 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d038085 |
| Parent gene annotation |
Protein RETICULATA-RELATED 4 chloroplastic |
| Parent gene strand | + |
| Alternative splicing | Zm00001d038085_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d038085_T001:4 Zm00001d038085_T002:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_027744* |
| PMCS | 0.125924132 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
147229552-147229557(+) 147230658-147229642(+) 147229641-147230689(-) |
| Potential amino acid sequence |
MAIVADFMLVWLPAPTVSLQPPLAMNSGAIAKFFYNCPDNAFQVALSGTSYSLLQRVGAILRNG AKLFAVGTSASLIGTGVTNALIKARQAASKDFAGEVENIPILSTSVAYGVYMAVSSNLRSWQ*( +) MVCTWQFPVTSGHGNSCRFYACMASCSNRVFTATTSDEFWSHC*(+) MAPEFIASGGCKDTVGAGSHTSIKSATIAMT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |