Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0576800_circ_g.1 |
| ID in PlantcircBase | osa_circ_029069 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 28722742-28723018 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0576800 |
| Parent gene annotation |
Similar to Blast and wounding induced mitogen-activated protein kinase. (Os05t0576800-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0576800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.323158574 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28722964-28722763(+) 28722977-28722780(+) 28722757-28722963(-) 28722861-28722974(-) |
| Potential amino acid sequence |
MWQLDGIVPQSCVAPFFQSKCFPSGS*(+) MVSCPRVVWLLFFKASVFHRDLKPKNILANADCKLKVCDFGLARVSFNDTPSAIFWTDYVATRW YRAPELCGSFFSKQVFSIGILSPRIF*(+) MENTCFEKKEPHNSGARYHLVAT*(-) MADGVSLNDTRARPKSQTFSLQSALARIFLGLRSRWKTLALKKRSHTTLGHDTI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |