Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0794900_circ_g.3 |
| ID in PlantcircBase | osa_circ_016920 |
| Alias | Os_ciR8174 |
| Organism | Oryza sativa |
| Position | chr2: 33786859-33788187 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0794900 |
| Parent gene annotation |
Formin-like protein 7. (Os02t0794900-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0794900_circ_g.4 Os02g0794900_circ_g.5 Os02g0794900_circ_g.6 Os02g0794900_circ_g.7 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0794900-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.128892407 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33788012-33788179(-) |
| Potential amino acid sequence |
MQAITKGLEKVEQELTTSEKDGPGSEIFYKKLKEFLADAQAEGRSLAFLYSTAGKSADSLAHYF GEDPVRCPFEQGSF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |