Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0523300_circ_g.1 |
ID in PlantcircBase | osa_circ_028583 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 26053395-26053458 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os05g0523300 |
Parent gene annotation |
Similar to IAA8 (Fragment). (Os05t0523300-01) |
Parent gene strand | - |
Alternative splicing | Os05g0523300_circ_igg.1 |
Support reads | 3 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0523300-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083333333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26053397-26053412(+) 26053404-26053440(-) |
Potential amino acid sequence |
MSWGSSDLLITLNLLTVETNTHVMGKF*(+) MTWVFVSTVKRLRVMRRSELPHDMGICFDC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |