Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0208000_circ_g.2 |
| ID in PlantcircBase | osa_circ_026986 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 6697960-6699561 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0208000 |
| Parent gene annotation |
Similar to 2-oxoglutarate/malate translocator. (Os05t0208000-01) ;Similar to Mitochondrial 2-oxoglutarate/malate carrier protein. (Os05t0208000-02);Similar to 2-oxoglutarate/malate translocator . (Os05t0208000-03);Similar to Mitochondrial 2-oxoglutarate/mala te carrier protein. (Os05t0208000-04) |
| Parent gene strand | + |
| Alternative splicing | Os05g0208000_circ_g.1 Os05g0208050_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0208000-01:2 Os05t0208000-04:1 Os05t0208000-02:1 Os05t0208000-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168608645 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6699334-6699220(+) 6699500-6699220(+) 6697995-6699505(-) |
| Potential amino acid sequence |
MQADSTLPIAQRRNYKNAFHALYRIIADEGVLALWKGAGPTVVRAMALNMGMLASYDQSVELFR DKLGAGEVSTVLGFVSWFTKAGDIYYCSSWILQGSDKQSN*(+) MIRVLSYSETNLVLEKFRLYLGLSAGLLRQATYTTARLGSFRVLTNKAIEKNDGKPLPLVQKAF IGLTAGAIGACVGSPADLALIRMQADSTLPIAQRRNYKNAFHALYRIIADEGVLALWKGAGPTV VRAMALNMGMLASYDQSVELFRDKLGAGEVSTVLGFVSWFTKAGDIYYCSSWILQGSDKQSN*( +) MSPALVNQLTNPSTVETSPAPSLSLNSSTL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |