Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0673500_circ_g.1 |
| ID in PlantcircBase | osa_circ_035269 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 28470198-28471650 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0673500 |
| Parent gene annotation |
Similar to ASF/SF2-like pre-mRNA splicing factor SRP32''. (Os07t 0673500-01);Similar to cDNA clone:001-208-C08, full insert seque nce (Fragment). (Os07t0673500-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0673500_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0673500-01:4 Os07t0673500-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.149484928 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28471447-28470421(+) 28470297-28471649(-) |
| Potential amino acid sequence |
MLNGVMTFPWETCLDSCFCCSCDLDFGFGFVSMNGCAFHHTPSHQEIGNVMGSCLGYVSWGGSC LGCVSWGLLHHHWQEKYLETEILLVICKKFQK*(+) MVMQQAPRNAAQAGAPPRNVAQAGAHHVPDLLM*(-) |
| Sponge-miRNAs | osa-miR169i-5p.2 osa-miR1861a |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |