Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0134050_circ_g.1 |
ID in PlantcircBase | osa_circ_029562 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 1823597-1823850 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0134050 |
Parent gene annotation |
Similar to EMB1067 (EMBRYO DEFECTIVE 1067); tRNA 2'-phosphotrans ferase. (Os06t0134050-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0134050-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_002911 |
PMCS | 0.301269849 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1823659-1823806(-) 1823646-1823806(-) |
Potential amino acid sequence |
MARLHVHFSSGLPTDGGVISDCYFRELVETHSISR*(-) MYISQVAYRQMGELLATVTSESLLKPILSADEVSVCVHGTYRKNLDSILHQGLKRMARLHVHFS SGLPTDGGVISDCYFRELVETHSISR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |