Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G11380_circ_g.8 |
| ID in PlantcircBase | ath_circ_037581 |
| Alias | At_ciR3899, Ath_circ_FC3239, AT5G11380_C2 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 3632738-3633022 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, CIRI-full, PcircRNA_finder, find_circ, CIRI2 |
| Parent gene | AT5G11380 |
| Parent gene annotation |
1-D-deoxyxylulose 5-phosphate synthase-like protein |
| Parent gene strand | + |
| Alternative splicing | AT5G11380_circ_g.4 AT5G11380_circ_g.5 AT5G11380_circ_g.6 AT5G11380_circ_g.7 |
| Support reads | 2/2 |
| Tissues | leaf/seed, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G11380.1:1 AT5G11380.3:1 AT5G11380.4:1 AT5G11380.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.699982278 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3632798-3633019(+) |
| Potential amino acid sequence |
MVQNCLHAHSLLSKLGLNVTVADARFCKPLDIKLVRDLCQNHKFLITVEEGCVGGFGSHVAQFI ALDGQLDGNIKIGRGRVLVEGQDVALLGYGAMVQNCLHAHSLLSKLGLNVTVADARFCKPLDIK LVRDLCQNHKFLITVEEGCVGGFGSHVAQFIALDGQLDGNIKIGRGRVLVEGQDVALLGYGAMV QNCLHAHSLLSKLGLNVTVADARFCKPLDIKLVRDLCQNHKFLITVEEGCVGGFGSHVAQFIAL DGQLDGNIKIGRGRVLVEGQDVALLGYGAMVQNCLHAHSLLSKLGLNVTVADARFCKPLDIKLV RDLCQNHKFLITVEEGCVGGFGSHVAQFIALDGQLDGNIK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |