Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014340_circ_g.7 |
ID in PlantcircBase | zma_circ_008466 |
Alias | Zm05circ00039, zma_circ_0001814, GRMZM2G151195_C3 |
Organism | Zea mays |
Position | chr5: 41564347-41565107 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d014340 |
Parent gene annotation |
Whole genome shotgun sequence of line PN40024 scaffold_7.assembl y12x (Fragment) |
Parent gene strand | - |
Alternative splicing | Zm00001d014340_circ_g.1 Zm00001d014340_circ_g.2 Zm00001d014340_circ_g.3 Zm00001d014340_circ_g.4 Zm00001d014340_circ_g.5 Zm00001d014340_circ_g.6 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d014340_T001:2 Zm00001d014340_T009:2 Zm00001d014340_T012:2 Zm00001d014340_T005:2 Zm00001d014340_T004:2 Zm00001d014340_T007:2 Zm00001d014340_T010:3 Zm00001d014340_T014:2 Zm00001d014340_T002:2 Zm00001d014340_T013:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.143292444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
41564971-41565067(-) |
Potential amino acid sequence |
MYGKSLLHEGSCEPRIQEVEAEVQEPSVHPWGGLSTTKDGILTLLDCFINAKSLHVIQNVFDNA RAREREREMLYPDACGGGGRGWISPVIPNYGRGHGTRDTCALHTAHLSCDTLVDFWSALGEETR SSLLRMKEEDFIERLMHSFGVPCHLMHDMSC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |