Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G52520_circ_g.1 |
| ID in PlantcircBase | ath_circ_043730 |
| Alias | At_ciR4195 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 21311527-21311919 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT5G52520 |
| Parent gene annotation |
Proline--tRNA ligase, chloroplastic/mitochondrial |
| Parent gene strand | + |
| Alternative splicing | AT5G52520_circ_g.2 AT5G52520_circ_g.3 AT5G52520_circ_g.4 AT5G52520_circ_g.5 AT5G52520_circ_g.6 AT5G52520_circ_g.7 AT5G52520_circ_g.8 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G52520.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.218623596 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21311569-21311916(+) |
| Potential amino acid sequence |
MYFPQFIPYSFIEKEASHVEGFSPELALVTVGGGKELEEKLVDYLNVKFKETGHSNMYFPQFIP YSFIEKEASHVEGFSPELALVTVGGGKELEEKLVDYLNVKFKETGHSNMYFPQFIPYSFIEKEA SHVEGFSPELALVTVGGGKELEEKLVDYLNVKFKETGHSNMYFPQFIPYSFIEKEASHVEGFSP ELALVTVGGGKELEEKLV(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |